General Information

  • ID:  hor005641
  • Uniprot ID:  P81768
  • Protein name:  Neurophysin 2
  • Gene name:  AVP
  • Organism:  Loxodonta africana (African elephant)
  • Family:  Vasopressin/oxytocin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Loxodonta (genus), Elephantidae (family), Proboscidea (order), Afrotheria (superorder), Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AMSDMELRQCLPCGPGGKGRCFGPSICCGEELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCYEESCVTEPECREGAGIH
  • Length:  92(1-92)
  • Propeptide:  AMSDMELRQCLPCGPGGKGRCFGPSICCGEELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCYEESCVTEPECREGAGIH
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neurophysin 2 specifically binds vasopressin
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  AVPR2, AVPR1A
  • Target Unid:   G3U149, G3SXB7
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  10-54; 13-27; 21-44; 28-34; 61-73; 67-85; 74-79
  • Structure ID:  AF-P81768-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P81768-F1.pdbhor005641_AF2.pdbhor005641_ESM.pdb

Physical Information

Mass: 1116620 Formula: C389H616N116O132S16
Absent amino acids: W Common amino acids: GC
pI: 4.41 Basic residues: 8
Polar residues: 40 Hydrophobic residues: 19
Hydrophobicity: -22.93 Boman Index: -12582
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 47.83
Instability Index: 5862.61 Extinction Coefficient cystines: 3855
Absorbance 280nm: 42.36

Literature

  • PubMed ID:  7822104
  • Title:  Amino acid sequence and properties of vasopressin-associated elephant neurophysin